PDB entry 1bld

View 1bld on RCSB PDB site
Description: basic fibroblast growth factor (fgf-2) mutant with cys 78 replaced by ser and cys 96 replaced by ser, nmr
Deposited on 1996-05-20, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1bld__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bld_ (-)
  maegeittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
  klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
  tswyvalkrtgqyklgsktgpgqkailflpmsaks