PDB entry 1bg5

View 1bg5 on RCSB PDB site
Description: crystal structure of the ankyrin binding domain of alpha-na,k-ATPase as a fusion protein with glutathione s-transferase
Class: ankyrin binding
Keywords: ankyrin binding, ATPase, glutathione-s-transferase, carrier crystallization, ion transport
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fusion protein of alpha-na,k-ATPase with glutathione s-transferase
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08515 (0-217)
  Domains in SCOPe 2.07: d1bg5a1, d1bg5a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bg5A (A:)
  mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
  gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
  dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
  krieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgssyyqeaksskimes
  fknmvpqqalvnss