Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries) Uniprot P08515 |
Domain d1bg5a2: 1bg5 A:1-80 [33017] Other proteins in same PDB: d1bg5a1 |
PDB Entry: 1bg5 (more details), 2.6 Å
SCOPe Domain Sequences for d1bg5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg5a2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid gdvkltqsmaiiryiadkhn
Timeline for d1bg5a2: