PDB entry 1bc7

View 1bc7 on RCSB PDB site
Description: serum response factor accessory protein 1a (sap-1)/dna complex
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-21, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.222
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Domains in SCOP 1.55: d1bc7c_

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bc7C (C:)
  mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
  ralryyyvkniikkvngqkfvykfvsypeilnm