PDB entry 1bbz

View 1bbz on RCSB PDB site
Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Class: complex (transferase/peptide)
Keywords: complex (transferase/peptide), signal transduction, sh3 domain
Deposited on 1998-04-28, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bbza_
  • Chain 'B':
    Compound: peptide p41
    Database cross-references and differences (RAF-indexed):
    • PDB 1BBZ (Start-9)
  • Chain 'C':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bbzc_
  • Chain 'D':
    Compound: peptide p41
    Database cross-references and differences (RAF-indexed):
    • PDB 1BBZ (Start-9)
  • Chain 'E':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bbze_
  • Chain 'F':
    Compound: peptide p41
    Database cross-references and differences (RAF-indexed):
    • PDB 1BBZ (Start-9)
  • Chain 'G':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bbzg_
  • Chain 'H':
    Compound: peptide p41
    Database cross-references and differences (RAF-indexed):
    • PDB 1BBZ (Start-9)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzA (A:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzC (C:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzE (E:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzG (G:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'H':
    No sequence available.