Lineage for d1bbza_ (1bbz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782866Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 2782867Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)
  8. 2782868Domain d1bbza_: 1bbz A: [24477]
    complexed with so4

Details for d1bbza_

PDB Entry: 1bbz (more details), 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
PDB Compounds: (A:) abl tyrosine kinase

SCOPe Domain Sequences for d1bbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbza_ b.34.2.1 (A:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOPe Domain Coordinates for d1bbza_:

Click to download the PDB-style file with coordinates for d1bbza_.
(The format of our PDB-style files is described here.)

Timeline for d1bbza_: