Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Abl tyrosine kinase, SH3 domain [50052] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries) |
Domain d1bbzc_: 1bbz C: [24478] complexed with so4 |
PDB Entry: 1bbz (more details), 1.65 Å
SCOPe Domain Sequences for d1bbzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbzc_ b.34.2.1 (C:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
Timeline for d1bbzc_: