PDB entry 1b9x
View 1b9x on RCSB PDB site
Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin
Class: signaling protein
Keywords: phosducin, transducin, beta-gamma, signal transduction, regulation, phosphorylation, g proteins, thioredoxin, vision, meka, complex (transducer/ transduction), signaling protein
Deposited on
1999-02-16, released
1999-02-23
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (transducin)
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1b9xa_ - Chain 'B':
Compound: protein (transducin)
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1b9xb_ - Chain 'C':
Compound: protein (phosducin)
Species: Rattus norvegicus [TaxId:10116]
Gene: RAT PDC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1b9xc_ - Heterogens: GD, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b9xA (A:)
mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b9xB (B:)
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1b9xC (C:)
meeaasqsleedfegqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrd
dkdskermsrkmeiqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletg
eqfletiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdr
fssdvlptllvykggelisnfisvaeqfaedffaadvesflneygllpereihdlgqtnt
ededie
Sequence, based on observed residues (ATOM records): (download)
>1b9xC (C:)
egqathtgpkgvindwrkfklesedegclrkyrrqcmqdmhqklsfgprygfvyeletge
qfletiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrf
ssdvlptllvykggelisnfisvaeqfaedffaadvesflneygllper