SCOPe 2.02: Domain d1b9xc_: 1b9x C:

Lineage for d1b9xc_ (1b9x C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.6: Phosducin [52888] (1 protein)

6. Protein Phosducin [52889] (2 species)
   the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries)

8. Domain d1b9xc_: 1b9x C: [33053]
   Other proteins in same PDB: d1b9xa_, d1b9xb_
   complexed with gd

Details for d1b9xc_

PDB Entry: 1b9x, 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin

PDB Compounds: (C:) protein (phosducin)

SCOPe Domain Sequences for d1b9xc_:

Sequence, based on SEQRES records:

>d1b9xc_ c.47.1.6 (C:) Phosducin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkme
iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv
ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk
ggelisnfisvaeqfaedffaadvesflneygllper

Sequence, based on observed residues (ATOM records):

>d1b9xc_ c.47.1.6 (C:) Phosducin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
egqathtgpkgvindwrkfklesedegclrkyrrqcmqdmhqklsfgprygfvyeletge
qfletiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrf
ssdvlptllvykggelisnfisvaeqfaedffaadvesflneygllper

Timeline for d1b9xc_:

• d1b9xc_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9xc_ appears in SCOPe 2.01
  
• d1b9xc_ appears in SCOPe 2.03
  
• d1b9xc_ appears in the current release, SCOPe 2.08