PDB entry 1avs

View 1avs on RCSB PDB site
Description: x-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
Class: muscle contraction
Keywords: muscle contraction, calcium-activated, troponin, e-f hand calcium-binding protein
Deposited on 1997-09-19, released 1997-12-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1avsa_
  • Chain 'B':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1avsb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avsA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avsA (A:)
    qaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevd
    edgsgtidfeeflvmmvrqmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1avsB (B:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avsB (B:)
    qqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieev
    dedgsgtidfeeflvmmvrqmk