Lineage for d1avsa_ (1avs A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490325Protein Troponin C [47503] (6 species)
  7. 1490326Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1490331Domain d1avsa_: 1avs A: [17226]
    calcium-saturated N-terminal domain
    complexed with ca

Details for d1avsa_

PDB Entry: 1avs (more details), 1.75 Å

PDB Description: x-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1avsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
qaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevd
edgsgtidfeeflvmmvrqmk

SCOPe Domain Coordinates for d1avsa_:

Click to download the PDB-style file with coordinates for d1avsa_.
(The format of our PDB-style files is described here.)

Timeline for d1avsa_: