PDB entry 1aoi

View 1aoi on RCSB PDB site
Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Deposited on 1997-07-03, released 1998-09-30
The last revision prior to the SCOP 1.57 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1aoia_
  • Chain 'B':
    Domains in SCOP 1.57: d1aoib_
  • Chain 'C':
    Domains in SCOP 1.57: d1aoic_
  • Chain 'D':
    Domains in SCOP 1.57: d1aoid_
  • Chain 'E':
    Domains in SCOP 1.57: d1aoie_
  • Chain 'F':
    Domains in SCOP 1.57: d1aoif_
  • Chain 'G':
    Domains in SCOP 1.57: d1aoig_
  • Chain 'H':
    Domains in SCOP 1.57: d1aoih_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiB (B:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiC (C:)
    gkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeil
    elagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiD (D:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiE (E:)
    latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk
    tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiF (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiG (G:)
    akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
    dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiH (H:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak