Lineage for d1aoib_ (1aoi B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46354Protein Histone H4 [47125] (3 species)
  7. 46355Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (1 PDB entry)
  8. 46356Domain d1aoib_: 1aoi B: [16470]
    Other proteins in same PDB: d1aoia_, d1aoic_, d1aoid_, d1aoie_, d1aoig_, d1aoih_

Details for d1aoib_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoib_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1aoib_:

Click to download the PDB-style file with coordinates for d1aoib_.
(The format of our PDB-style files is described here.)

Timeline for d1aoib_: