Lineage for d1aoia_ (1aoi A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46341Protein Histone H3 [47122] (2 species)
  7. 46342Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (2 PDB entries)
  8. 46345Domain d1aoia_: 1aoi A: [16462]
    Other proteins in same PDB: d1aoib_, d1aoic_, d1aoid_, d1aoif_, d1aoig_, d1aoih_

Details for d1aoia_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoia_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1aoia_:

Click to download the PDB-style file with coordinates for d1aoia_.
(The format of our PDB-style files is described here.)

Timeline for d1aoia_: