PDB entry 1aky

View 1aky on RCSB PDB site
Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Deposited on 1995-07-28, released 1995-11-14
The last revision prior to the SCOP 1.61 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aky_ (-)
    esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
    vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
    ellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqrsddnadalkkrlaayha
    qtepivdfykktgiwagvdasqppatvwadilnklgkn