Lineage for d1aky_1 (1aky 3-130,169-220)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179165Protein Adenylate kinase [52554] (8 species)
  7. 179177Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
  8. 179178Domain d1aky_1: 1aky 3-130,169-220 [31896]
    Other proteins in same PDB: d1aky_2

Details for d1aky_1

PDB Entry: 1aky (more details), 1.63 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d1aky_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnklgk
n

SCOP Domain Coordinates for d1aky_1:

Click to download the PDB-style file with coordinates for d1aky_1.
(The format of our PDB-style files is described here.)

Timeline for d1aky_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aky_2