PDB entry 1akt

View 1akt on RCSB PDB site
Description: g61n oxidized flavodoxin mutant
Deposited on 1997-05-27, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-12, with a file datestamp of 1999-04-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1akt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akt_ (-)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwn
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai