PDB entry 1ajo

View 1ajo on RCSB PDB site
Description: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-127
Deposited on 1997-05-07, released 1998-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ajoa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ajob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajoA (A:)
    ghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtg
    vddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctw
    rannvnftndgklklgltssaynkfdcaeyrstniygyglyevsmkpakntgivssffty
    tgpahgtqwdeidieflgkdttkvqfnyytng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ajoB (B:)
    vgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwng
    tgvddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnc
    twrannvnftndgklklgltssaynkfdcaeyrstniygyglyevsmkpakntgivssff
    tytgpahgtqwdeidieflgkdttkvqfnyytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajoB (B:)
    vgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwng
    tgvddwlgsynganplyaeydwvkytsnqggsffepfnsynsgtwekadgysnggvfnct
    wrannvnftndgklklgltssaynkfdcaeyrstniygyglyevsmkpakntgivssfft
    ytgpahgtqwdeidieflgkdttkvqfnyytng