Lineage for d1utcb2 (1utc B:3-330)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379749Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 379871Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 379872Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (1 protein)
  6. 379873Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 379874Species Rat (Rattus norvegicus) [TaxId:10116] [50992] (4 PDB entries)
  8. 379876Domain d1utcb2: 1utc B:3-330 [99917]
    Other proteins in same PDB: d1utca1, d1utcb1
    complexed with peptide tlpwdlwtt from amphiphysin

Details for d1utcb2

PDB Entry: 1utc (more details), 2.3 Å

PDB Description: clathrin terminal domain complexed with tlpwdlwtt

SCOP Domain Sequences for d1utcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utcb2 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus)}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

SCOP Domain Coordinates for d1utcb2:

Click to download the PDB-style file with coordinates for d1utcb2.
(The format of our PDB-style files is described here.)

Timeline for d1utcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1utcb1