Lineage for d1uqya_ (1uqy A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340267Protein Xylanase [51488] (6 species)
  7. 1340289Species Cellvibrio mixtus [TaxId:39650] [102064] (4 PDB entries)
  8. 1340293Domain d1uqya_: 1uqy A: [99802]
    complexed with mg; mutant

Details for d1uqya_

PDB Entry: 1uqy (more details), 1.72 Å

PDB Description: xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with xylopentaose
PDB Compounds: (A:) endoxylanase

SCOPe Domain Sequences for d1uqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqya_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]}
glksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnwk
dadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagry
kgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndyniert
gkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsldv
dvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidra
tfwgvsddaswlngfpipgrtnypllfdrklqpkdayfrlldlkrle

SCOPe Domain Coordinates for d1uqya_:

Click to download the PDB-style file with coordinates for d1uqya_.
(The format of our PDB-style files is described here.)

Timeline for d1uqya_: