Lineage for d1un1b_ (1un1 B:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) 
Family b.29.1.2: beta-Glucanase-like [49925] (4 proteins) 
Protein Xyloglucan endotransglycosylase [101634] (1 species) Species European aspen (Populus tremula) [TaxId:113636] [101635] (2 PDB entries) 
Domain d1un1b_: 1un1 B: [99644]
complexed with au, bma, nag
Details for d1un1b_
PDB Entry: 1un1 (more details), 2.1 Å
PDB Description: xyloglucan endotransglycosylase native structure.
SCOP Domain Sequences for d1un1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1un1b_ b.29.1.2 (B:) Xyloglucan endotransglycosylase {European aspen (Populus tremula)}
vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
iynyctdrsrypsmppeckrdrdi
SCOP Domain Coordinates for d1un1b_:
Click to download the PDB-style file with coordinates for d1un1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1un1b_:
- d1un1b_ is new in SCOP 1.67
- d1un1b_ appears in SCOP 1.69
- d1un1b_ appears in the current release, SCOPe 2.08
View in 3D
