SCOP 1.67: Domain d1uh3a1: 1uh3 A:1-122

Lineage for d1uh3a1 (1uh3 A:1-122)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (6 PDB entries)

8. Domain d1uh3a1: 1uh3 A:1-122 [99388]
   Other proteins in same PDB: d1uh3a2, d1uh3a3
   complexed with aci, ca, glc, gld

Details for d1uh3a1

PDB Entry: 1uh3, 2.6 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase/acarbose complex

SCOP Domain Sequences for d1uh3a1:

Sequence; same for both SEQRES and ATOM records:

>d1uh3a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

Timeline for d1uh3a1:

• d1uh3a1 is new in SCOP 1.67
  
• d1uh3a1 appears in SCOP 1.69
  
• d1uh3a1 appears in the current release, SCOPe 2.08