SCOPe 2.04: Domain d1uf9b_: 1uf9 B:

Lineage for d1uf9b_ (1uf9 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Dephospho-CoA kinase [75187] (4 species)

7. Species Thermus thermophilus [TaxId:274] [102344] (1 PDB entry)
   TT1252

8. Domain d1uf9b_: 1uf9 B: [99327]
   structural genomics
   complexed with atp, po4

Details for d1uf9b_

PDB Entry: 1uf9, 2.8 Å

PDB Description: Crystal structure of TT1252 from Thermus thermophilus

PDB Compounds: (B:) TT1252 protein

SCOPe Domain Sequences for d1uf9b_:

Sequence; same for both SEQRES and ATOM records:

>d1uf9b_ c.37.1.1 (B:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}
khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr
ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl
hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler
alkavlaeltg

Timeline for d1uf9b_:

• d1uf9b_ first appeared in SCOP 1.67
  
• d1uf9b_ appears in SCOPe 2.03
  
• d1uf9b_ appears in SCOPe 2.05
  
• d1uf9b_ appears in the current release, SCOPe 2.08