SCOPe 2.04: Domain d1ucxc2: 1ucx C:297-470

Lineage for d1ucxc2 (1ucx C:297-470)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)

8. Domain d1ucxc2: 1ucx C:297-470 [99197]
   mutant

Details for d1ucxc2

PDB Entry: 1ucx, 3.2 Å

PDB Description: crystal structure of proglycinin c12g mutant

PDB Compounds: (C:) glycinin g1

SCOPe Domain Sequences for d1ucxc2:

Sequence; same for both SEQRES and ATOM records:

>d1ucxc2 b.82.1.2 (C:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
ictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphyn
lnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfk
tndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqes

Timeline for d1ucxc2:

• d1ucxc2 first appeared in SCOP 1.67
  
• d1ucxc2 appears in SCOPe 2.03
  
• d1ucxc2 appears in SCOPe 2.05
  
• d1ucxc2 appears in the current release, SCOPe 2.08