![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Dephospho-CoA kinase [75187] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
![]() | Domain d1t3ha_: 1t3h A: [99117] structural genomics; NESG target ER57 complexed with so4 |
PDB Entry: 1t3h (more details), 2.5 Å
SCOPe Domain Sequences for d1t3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ha_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd aiasdvarlhahylqlasqfvsqekpe
Timeline for d1t3ha_: