SCOP 1.67: Domain d1su9a_: 1su9 A:

Lineage for d1su9a_ (1su9 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (17 proteins)

6. Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102456] (2 PDB entries)

8. Domain d1su9a_: 1su9 A: [99000]

Details for d1su9a_

PDB Entry: 1su9, 1.95 Å

PDB Description: Reduced structure of the soluble domain of ResA

SCOP Domain Sequences for d1su9a_:

Sequence; same for both SEQRES and ATOM records:

>d1su9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcepckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpge

Timeline for d1su9a_:

• d1su9a_ is new in SCOP 1.67
  
• d1su9a_ appears in SCOP 1.69
  
• d1su9a_ appears in the current release, SCOPe 2.08