SCOPe 2.07: Domain d1sq0a_: 1sq0 A:

Lineage for d1sq0a_ (1sq0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)

8. Domain d1sq0a_: 1sq0 A: [98959]
   Other proteins in same PDB: d1sq0b_
   complexed with platelet glycoprotein Ib alpha chain

Details for d1sq0a_

PDB Entry: 1sq0, 2.6 Å

PDB Description: crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution

PDB Compounds: (A:) Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II]

SCOPe Domain Sequences for d1sq0a_:

Sequence; same for both SEQRES and ATOM records:

>d1sq0a_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
dfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshay
iglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasq
epqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleq
qrdeivsylcdlapeapp

Timeline for d1sq0a_:

• d1sq0a_ first appeared in SCOP 1.67
  
• d1sq0a_ appears in SCOPe 2.06
  
• d1sq0a_ appears in the current release, SCOPe 2.08