SCOPe 2.03: Domain d1sm4a1: 1sm4 A:67-207

Lineage for d1sm4a1 (1sm4 A:67-207)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (1 PDB entry)

8. Domain d1sm4a1: 1sm4 A:67-207 [98913]
   Other proteins in same PDB: d1sm4a2, d1sm4b2
   complexed with fad, po4

Details for d1sm4a1

PDB Entry: 1sm4, 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

PDB Compounds: (A:) chloroplast ferredoxin-NADP+ oxidoreductase

SCOPe Domain Sequences for d1sm4a1:

Sequence; same for both SEQRES and ATOM records:

>d1sm4a1 b.43.4.2 (A:67-207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum) [TaxId: 4072]}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

Timeline for d1sm4a1:

• d1sm4a1 first appeared in SCOP 1.67
  
• d1sm4a1 appears in SCOPe 2.02
  
• d1sm4a1 appears in SCOPe 2.04
  
• d1sm4a1 appears in the current release, SCOPe 2.08