![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) ![]() |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (41 PDB entries) |
![]() | Domain d1skud1: 1sku D:6-100 [98908] Other proteins in same PDB: d1skua1, d1skua2, d1skub2, d1skuc1, d1skuc2, d1skud2 complexed with mli, zn; mutant |
PDB Entry: 1sku (more details), 2.6 Å
SCOP Domain Sequences for d1skud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skud1 d.58.2.1 (D:6-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} klqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientf lsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1skud1: