Lineage for d1s7vd1 (1s7v D:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654773Domain d1s7vd1: 1s7v D:182-276 [98688]
    Other proteins in same PDB: d1s7va2, d1s7vb_, d1s7vd2, d1s7ve_
    mutant

Details for d1s7vd1

PDB Entry: 1s7v (more details), 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1s7vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7vd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOP Domain Coordinates for d1s7vd1:

Click to download the PDB-style file with coordinates for d1s7vd1.
(The format of our PDB-style files is described here.)

Timeline for d1s7vd1: