Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Vignain (bean endopeptidase) [102719] (1 species) |
Species Castor bean (Ricinus communis) [TaxId:3988] [102720] (1 PDB entry) |
Domain d1s4va_: 1s4v A: [98511] complexed with so4 |
PDB Entry: 1s4v (more details), 2 Å
SCOPe Domain Sequences for d1s4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} tvpasvdwrkkgavtsvkdqgqcgscwafstivaveginqiktnklvslseqelvdcdtd qnqgcngglmdyafefikqrggitteanypyeaydgtcdvskenapavsidghenvpend enallkavanqpvsvaidaggsdfqfysegvftgscgteldhgvaivgygttidgtkywt vknswgpewgekgyirmergisdkeglcgiameasypikkssnn
Timeline for d1s4va_: