Lineage for d1s4va_ (1s4v A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2534122Protein Vignain (bean endopeptidase) [102719] (1 species)
  7. 2534123Species Castor bean (Ricinus communis) [TaxId:3988] [102720] (1 PDB entry)
  8. 2534124Domain d1s4va_: 1s4v A: [98511]
    complexed with so4

Details for d1s4va_

PDB Entry: 1s4v (more details), 2 Å

PDB Description: The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm
PDB Compounds: (A:) cysteine endopeptidase

SCOPe Domain Sequences for d1s4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]}
tvpasvdwrkkgavtsvkdqgqcgscwafstivaveginqiktnklvslseqelvdcdtd
qnqgcngglmdyafefikqrggitteanypyeaydgtcdvskenapavsidghenvpend
enallkavanqpvsvaidaggsdfqfysegvftgscgteldhgvaivgygttidgtkywt
vknswgpewgekgyirmergisdkeglcgiameasypikkssnn

SCOPe Domain Coordinates for d1s4va_:

Click to download the PDB-style file with coordinates for d1s4va_.
(The format of our PDB-style files is described here.)

Timeline for d1s4va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s4vb_