SCOP 1.75: Domain d1s46a1: 1s46 A:555-628

Lineage for d1s46a1 (1s46 A:555-628)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Amylosucrase [69328] (1 species)

7. Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)

8. Domain d1s46a1: 1s46 A:555-628 [98473]
   Other proteins in same PDB: d1s46a2
   complexed with glc; mutant

Details for d1s46a1

PDB Entry: 1s46, 2.2 Å

PDB Description: covalent intermediate of the e328q amylosucrase mutant

PDB Compounds: (A:) amylosucrase

SCOP Domain Sequences for d1s46a1:

Sequence; same for both SEQRES and ATOM records:

>d1s46a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

Timeline for d1s46a1:

• d1s46a1 first appeared in SCOP 1.67
  
• d1s46a1 appears in SCOP 1.73
  
• d1s46a1 appears in SCOPe 2.01
  
• d1s46a1 appears in the current release, SCOPe 2.08