Lineage for d1s46a1 (1s46 A:555-628)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675800Protein Amylosucrase [69328] (1 species)
  7. 675801Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)
  8. 675811Domain d1s46a1: 1s46 A:555-628 [98473]
    Other proteins in same PDB: d1s46a2
    complexed with glc; mutant

Details for d1s46a1

PDB Entry: 1s46 (more details), 2.2 Å

PDB Description: covalent intermediate of the e328q amylosucrase mutant
PDB Compounds: (A:) amylosucrase

SCOP Domain Sequences for d1s46a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s46a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOP Domain Coordinates for d1s46a1:

Click to download the PDB-style file with coordinates for d1s46a1.
(The format of our PDB-style files is described here.)

Timeline for d1s46a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s46a2