Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries) |
Domain d1s2ya2: 1s2y A:290-401 [98409] Other proteins in same PDB: d1s2ya1, d1s2yb1 complexed with fad |
PDB Entry: 1s2y (more details), 2.12 Å
SCOPe Domain Sequences for d1s2ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2ya2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d1s2ya2: