SCOPe 2.03: Domain d1s22a1: 1s22 A:5-146

Lineage for d1s22a1 (1s22 A:5-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1s22a1: 1s22 A:5-146 [98364]
   complexed with atp, ca, edo, ula

Details for d1s22a1

PDB Entry: 1s22, 1.6 Å

PDB Description: Absolute Stereochemistry of Ulapualide A

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1s22a1:

Sequence, based on SEQRES records:

>d1s22a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1s22a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

Timeline for d1s22a1:

• d1s22a1 first appeared in SCOP 1.67
  
• d1s22a1 appears in SCOPe 2.02
  
• d1s22a1 appears in SCOPe 2.04
  
• d1s22a1 appears in the current release, SCOPe 2.08