Lineage for d1s0ua1 (1s0u A:230-347)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.3: Translation proteins [50447] (2 families) 
Family b.43.3.1: Elongation factors [50448] (8 proteins) 
Protein Initiation factor eIF2 gamma subunit, domain II [74962] (2 species) 
Species Archaeon Methanococcus jannaschii [TaxId:2190] [101788] (1 PDB entry) 
Domain d1s0ua1: 1s0u A:230-347 [98302]
Other proteins in same PDB: d1s0ua2, d1s0ua3
structural genomics
Details for d1s0ua1
PDB Entry: 1s0u (more details), 2.4 Å
PDB Description: eif2gamma apo
SCOP Domain Sequences for d1s0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii}
rdpdatprmyvarsfdinkpgteikdlkggvlggaiiqgvfkvgdeieirpgikvtegnk
tfwkplttkivslaagntilrkahpggligvgttldpyltksdaltgsvvglpgtlpp
SCOP Domain Coordinates for d1s0ua1:
Click to download the PDB-style file with coordinates for d1s0ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s0ua1:
- d1s0ua1 first appeared in SCOP 1.67
- d1s0ua1 appears in SCOP 1.71
- d1s0ua1 appears in the current release, SCOPe 2.08
View in 3D
