Class b: All beta proteins [48724] (149 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries) |
Domain d1rzpa2: 1rzp A:167-335 [98213] |
PDB Entry: 1rzp (more details), 1.9 Å
SCOP Domain Sequences for d1rzpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzpa2 b.6.1.3 (A:167-335) Nitrite reductase, NIR {Achromobacter cycloclastes} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv
Timeline for d1rzpa2:
View in 3D Domains from other chains: (mouse over for more information) d1rzpb1, d1rzpb2, d1rzpc1, d1rzpc2 |