![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
![]() | Domain d1rzic2: 1rzi C:108-213 [98171] Other proteins in same PDB: d1rzia1, d1rzib1, d1rzib2, d1rzic1, d1rzid1, d1rzid2, d1rzie1, d1rzif1, d1rzif2, d1rzig1, d1rzih1, d1rzih2, d1rzii1, d1rzij1, d1rzij2, d1rzik1, d1rzil1, d1rzil2, d1rzim1, d1rzin1, d1rzin2, d1rzio1, d1rzip1, d1rzip2 part of anti HIV-1 gp120-reactive Fab 47E |
PDB Entry: 1rzi (more details), 2.9 Å
SCOPe Domain Sequences for d1rzic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzic2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1rzic2:
![]() Domains from other chains: (mouse over for more information) d1rzia1, d1rzia2, d1rzib1, d1rzib2, d1rzid1, d1rzid2, d1rzie1, d1rzie2, d1rzif1, d1rzif2, d1rzig1, d1rzig2, d1rzih1, d1rzih2, d1rzii1, d1rzii2, d1rzij1, d1rzij2, d1rzik1, d1rzik2, d1rzil1, d1rzil2, d1rzim1, d1rzim2, d1rzin1, d1rzin2, d1rzio1, d1rzio2, d1rzip1, d1rzip2 |