SCOPe 2.08: Domain d1rzgb1: 1rzg B:1-107

Lineage for d1rzgb1 (1rzg B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1rzgb1: 1rzg B:1-107 [98156]
   Other proteins in same PDB: d1rzga1, d1rzga2, d1rzgb2, d1rzgc1, d1rzgc2, d1rzgd2
   part of anti HIV-1 gp120-reactive Fab 412D
   complexed with asp, cys

Details for d1rzgb1

PDB Entry: 1rzg, 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d

PDB Compounds: (B:) Fab 412d heavy chain

SCOPe Domain Sequences for d1rzgb1:

Sequence; same for both SEQRES and ATOM records:

>d1rzgb1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleik

Timeline for d1rzgb1:

• d1rzgb1 first appeared in SCOP 1.67
  
• d1rzgb1 appears in SCOPe 2.07