Lineage for d1rvjm_ (1rvj M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632696Protein M (medium) subunit [81481] (4 species)
  7. 2632697Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
    Uniprot P02953
  8. 2632740Domain d1rvjm_: 1rvj M: [97927]
    Other proteins in same PDB: d1rvjh1, d1rvjh2, d1rvjl_
    complexed with bcl, bph, cdl, fe2, lda, po4, spo, u10; mutant

Details for d1rvjm_

PDB Entry: 1rvj (more details), 2.75 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg h177 replaced with his
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1rvjm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvjm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOPe Domain Coordinates for d1rvjm_:

Click to download the PDB-style file with coordinates for d1rvjm_.
(The format of our PDB-style files is described here.)

Timeline for d1rvjm_: