Lineage for d1rupl2 (1rup L:108-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549861Domain d1rupl2: 1rup L:108-214 [97874]
    Other proteins in same PDB: d1ruph1, d1ruph2, d1rupl1
    part of cationic cyclization catalytic Fab 4C6
    complexed with bez, gol

Details for d1rupl2

PDB Entry: 1rup (more details), 1.4 Å

PDB Description: crystal structure (g) of native cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at aps beamline 19-id

SCOP Domain Sequences for d1rupl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rupl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1rupl2:

Click to download the PDB-style file with coordinates for d1rupl2.
(The format of our PDB-style files is described here.)

Timeline for d1rupl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rupl1