| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain [101521] (1 species) |
| Species Clostridium thermocellum [TaxId:1515] [101522] (2 PDB entries) |
| Domain d1rq5a2: 1rq5 A:208-305 [97731] Other proteins in same PDB: d1rq5a1 complexed with ca |
PDB Entry: 1rq5 (more details), 2.4 Å
SCOPe Domain Sequences for d1rq5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rq5a2 b.1.18.2 (A:208-305) Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain {Clostridium thermocellum [TaxId: 1515]}
ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
yvhwldfsdfategigyyfelptvnsptnyshpfdirk
Timeline for d1rq5a2: