SCOPe 2.07: Domain d1rjpa1: 1rjp A:7-61

Lineage for d1rjpa1 (1rjp A:7-61)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.6: D-aminoacylase [82230] (1 protein)

6. Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species)

7. Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries)

8. Domain d1rjpa1: 1rjp A:7-61 [97572]
   Other proteins in same PDB: d1rjpa3
   complexed with act, cu, zn

Details for d1rjpa1

PDB Entry: 1rjp, 1.8 Å

PDB Description: Crystal structure of D-aminoacylase in complex with 100mM CuCl2

PDB Compounds: (A:) D-aminoacylase

SCOPe Domain Sequences for d1rjpa1:

Sequence; same for both SEQRES and ATOM records:

>d1rjpa1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]}
pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp

Timeline for d1rjpa1:

• d1rjpa1 first appeared in SCOP 1.67
  
• d1rjpa1 appears in SCOPe 2.06
  
• d1rjpa1 appears in the current release, SCOPe 2.08