Class b: All beta proteins [48724] (176 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein Carbonic anhydrase [51071] (10 species) |
Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries) |
Domain d1rj5b_: 1rj5 B: [97532] extracellular domain complexed with acy, cl, zn |
PDB Entry: 1rj5 (more details), 2.81 Å
SCOPe Domain Sequences for d1rj5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rj5b_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} wtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldlhn nghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhyds qsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvrel fpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpseplvq nyrvpqplnqrtifasf
Timeline for d1rj5b_: