Lineage for d1rj5b_ (1rj5 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1556573Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1556574Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1556575Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1556576Protein Carbonic anhydrase [51071] (10 species)
  7. 1557130Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries)
  8. 1557134Domain d1rj5b_: 1rj5 B: [97532]
    extracellular domain
    complexed with acy, cl, zn

Details for d1rj5b_

PDB Entry: 1rj5 (more details), 2.81 Å

PDB Description: crystal structure of the extracellular domain of murine carbonic anhydrase xiv
PDB Compounds: (B:) Carbonic anhydrase XIV

SCOPe Domain Sequences for d1rj5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj5b_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]}
wtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldlhn
nghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhyds
qsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvrel
fpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpseplvq
nyrvpqplnqrtifasf

SCOPe Domain Coordinates for d1rj5b_:

Click to download the PDB-style file with coordinates for d1rj5b_.
(The format of our PDB-style files is described here.)

Timeline for d1rj5b_: