Lineage for d1rg5h1 (1rg5 H:36-250)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1542883Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1542884Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1542885Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1542886Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1542887Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1542901Domain d1rg5h1: 1rg5 H:36-250 [97423]
    Other proteins in same PDB: d1rg5h2, d1rg5l_, d1rg5m_
    complexed with bcl, bph, cdl, fe, hto, lda, u10

Details for d1rg5h1

PDB Entry: 1rg5 (more details), 2.5 Å

PDB Description: structure of the photosynthetic reaction centre from rhodobacter sphaeroides carotenoidless strain r-26.1
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1rg5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg5h1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d1rg5h1:

Click to download the PDB-style file with coordinates for d1rg5h1.
(The format of our PDB-style files is described here.)

Timeline for d1rg5h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rg5h2