Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein Fusion glycoprotein E1 [75656] (1 species) |
Species Semliki forest virus [TaxId:11033] [75657] (3 PDB entries) |
Domain d1rera2: 1rer A:1-292 [97328] Other proteins in same PDB: d1rera1, d1rerb1, d1rerc1 complexed with br, ho, po4 |
PDB Entry: 1rer (more details), 3.2 Å
SCOPe Domain Sequences for d1rera2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rera2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]} yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive
Timeline for d1rera2:
View in 3D Domains from other chains: (mouse over for more information) d1rerb1, d1rerb2, d1rerc1, d1rerc2 |