Lineage for d1r8qf_ (1r8q F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359914Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 359915Family a.118.3.1: Sec7 domain [48426] (4 proteins)
  6. 359926Protein Exchange factor ARNO [48427] (1 species)
  7. 359927Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries)
  8. 359933Domain d1r8qf_: 1r8q F: [97246]
    Other proteins in same PDB: d1r8qa_, d1r8qb_
    complexed with afb, g3d, mg, zn; mutant

Details for d1r8qf_

PDB Entry: 1r8q (more details), 1.86 Å

PDB Description: full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain

SCOP Domain Sequences for d1r8qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8qf_ a.118.3.1 (F:) Exchange factor ARNO {Human (Homo sapiens)}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnly
dsirnepfkipedd

SCOP Domain Coordinates for d1r8qf_:

Click to download the PDB-style file with coordinates for d1r8qf_.
(The format of our PDB-style files is described here.)

Timeline for d1r8qf_: