Lineage for d1r6ha_ (1r6h A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395610Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins)
  6. 395640Protein Protein tyrosine phosphatase type IVa, pr-3 [102418] (1 species)
  7. 395641Species Human (Homo sapiens) [TaxId:9606] [102419] (1 PDB entry)
  8. 395642Domain d1r6ha_: 1r6h A: [97150]

Details for d1r6ha_

PDB Entry: 1r6h (more details)

PDB Description: solution structure of human prl-3

SCOP Domain Sequences for d1r6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ha_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa, pr-3 {Human (Homo sapiens)}
gshmarmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktp
lekdgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlval
aliesgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkdphthktr

SCOP Domain Coordinates for d1r6ha_:

Click to download the PDB-style file with coordinates for d1r6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1r6ha_: