PDB entry 1r6h

View 1r6h on RCSB PDB site
Description: Solution Structure of human PRL-3
Deposited on 2003-10-15, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r6ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r6hA (A:)
    gshmarmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktp
    lekdgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlval
    aliesgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkdphthktr