Lineage for d1r1nh_ (1r1n H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521176Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2521200Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries)
    Uniprot Q50964 23-331
  8. 2521226Domain d1r1nh_: 1r1n H: [96828]
    complexed with cn1, cnb, cnf

Details for d1r1nh_

PDB Entry: 1r1n (more details), 1.74 Å

PDB Description: Tri-nuclear oxo-iron clusters in the ferric binding protein from N. gonorrhoeae
PDB Compounds: (H:) Ferric-iron Binding Protein

SCOPe Domain Sequences for d1r1nh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1nh_ c.94.1.1 (H:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]}
ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk

SCOPe Domain Coordinates for d1r1nh_:

Click to download the PDB-style file with coordinates for d1r1nh_.
(The format of our PDB-style files is described here.)

Timeline for d1r1nh_: